Lineage for d2j7ae_ (2j7a E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925971Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 925972Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 926080Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 926174Protein automated matches [190276] (5 species)
    not a true protein
  7. 926175Species Desulfovibrio vulgaris [TaxId:882] [187896] (1 PDB entry)
  8. 926179Domain d2j7ae_: 2j7a E: [165930]
    automated match to d1oaha_
    complexed with act, ca, hem, lmt

Details for d2j7ae_

PDB Entry: 2j7a (more details), 2.3 Å

PDB Description: crystal structure of cytochrome c nitrite reductase nrfha complex from desulfovibrio vulgaris
PDB Compounds: (E:) cytochrome c nitrite reductase nrfa

SCOPe Domain Sequences for d2j7ae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7ae_ a.138.1.3 (E:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gcsdvstelktpvyktkltaeeirnsafkpefpkqyasyerndettvmteykgsvpfnkn
dnvnplpegyrhaqpylknlwlgypfmyeyrearghtyaiqdflhidrinryaekgglpa
tcwncktpkmmewvkesgdgfwakdvnefrdkidmkdhtigcatchdpqtmelritsvpl
tdylvsqgkdpkklprnemralvcgqchveyyfngptmgvnkkpvfpwaegfdpadmyry
ydkhgdlqvkgfegkfadwthpasktpmikaqhpeyetwingthgaagvtcadchmsytr
sddkkkisshwwtspmkdpemracrqchsdktpdylksrvlftqkrtfdlllaaqevsvk
aheavrlaneyqgakaagyddlmiqaremvrkgqffwdyvsaensvgfhnpakaldtlaq
sqqfsqkaidlameatqygigkdlsgdiktivppilkmnrklqqdpefmkthkwfqylpv
lpkadqvwdgqkrl

SCOPe Domain Coordinates for d2j7ae_:

Click to download the PDB-style file with coordinates for d2j7ae_.
(The format of our PDB-style files is described here.)

Timeline for d2j7ae_: