![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
![]() | Protein automated matches [190048] (11 species) not a true protein |
![]() | Species Aerococcus viridans [TaxId:1377] [187639] (5 PDB entries) |
![]() | Domain d2j6xb_: 2j6x B: [165920] automated match to d1tb3a1 complexed with fmn, zn |
PDB Entry: 2j6x (more details), 2.1 Å
SCOPe Domain Sequences for d2j6xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j6xb_ c.1.4.0 (B:) automated matches {Aerococcus viridans [TaxId: 1377]} ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl aqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysga tfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvkn kfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfvkgiqhpe dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd npygyey
Timeline for d2j6xb_: