SCOPe 2.08: Domain d2j5sb_: 2j5s B:

Lineage for d2j5sb_ (2j5s B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Nostoc sp. PCC 7120 [TaxId:103690] [187895] (2 PDB entries)

8. Domain d2j5sb_: 2j5s B: [165914]
   automated match to d1o8ua_
   complexed with kta, ni

Details for d2j5sb_

PDB Entry: 2j5s, 1.57 Å

PDB Description: structural of abdh, a beta-diketone hydrolase from the cyanobacterium anabaena sp. pcc 7120 bound to (s)-3-oxocyclohexyl acetic acid

PDB Compounds: (B:) beta-diketone hydrolase

SCOPe Domain Sequences for d2j5sb_:

Sequence; same for both SEQRES and ATOM records:

>d2j5sb_ c.14.1.0 (B:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}
qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
itatdlrnt

Timeline for d2j5sb_:

• d2j5sb_ first appeared in SCOPe 2.01
  
• d2j5sb_ appears in SCOPe 2.07