Lineage for d1buca1 (1buc A:233-383)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2246Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies)
  4. 2357Superfamily a.24.6: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47203] (1 family) (S)
  5. 2358Family a.24.6.1: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47204] (3 proteins)
  6. 2359Protein Butyryl-CoA dehydrogenase [47205] (1 species)
  7. 2360Species Megasphaera elsdenii [TaxId:907] [47206] (1 PDB entry)
  8. 2361Domain d1buca1: 1buc A:233-383 [16590]
    Other proteins in same PDB: d1buca2, d1bucb2

Details for d1buca1

PDB Entry: 1buc (more details), 2.5 Å

PDB Description: three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii

SCOP Domain Sequences for d1buca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buca1 a.24.6.1 (A:233-383) Butyryl-CoA dehydrogenase {Megasphaera elsdenii}
gkgfkiammtldggrigvaaqalgiaeaaladaveyskqrvqfgkplckfqsisfkladm
kmqieaarnlvykaackkqegkpftvdaaiakrvasdvamrvtteavqifggygyseeyp
varhmrdakitqiyegtnevqlmvtggallr

SCOP Domain Coordinates for d1buca1:

Click to download the PDB-style file with coordinates for d1buca1.
(The format of our PDB-style files is described here.)

Timeline for d1buca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1buca2