Lineage for d1buca1 (1buc A:233-383)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708345Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2708362Protein Butyryl-CoA dehydrogenase, C-domain [47205] (2 species)
  7. 2708363Species Megasphaera elsdenii [TaxId:907] [47206] (1 PDB entry)
  8. 2708364Domain d1buca1: 1buc A:233-383 [16590]
    Other proteins in same PDB: d1buca2, d1bucb2
    complexed with caa, fad

Details for d1buca1

PDB Entry: 1buc (more details), 2.5 Å

PDB Description: three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii
PDB Compounds: (A:) butyryl-coa dehydrogenase

SCOPe Domain Sequences for d1buca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]}
gkgfkiammtldggrigvaaqalgiaeaaladaveyskqrvqfgkplckfqsisfkladm
kmqieaarnlvykaackkqegkpftvdaaiakrvasdvamrvtteavqifggygyseeyp
varhmrdakitqiyegtnevqlmvtggallr

SCOPe Domain Coordinates for d1buca1:

Click to download the PDB-style file with coordinates for d1buca1.
(The format of our PDB-style files is described here.)

Timeline for d1buca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1buca2