SCOPe 2.05: Domain d2j4qa_: 2j4q A:

Lineage for d2j4qa_ (2j4q A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)

7. Species Escherichia coli [TaxId:562] [117336] (6 PDB entries)
   Uniprot P28248

8. Domain d2j4qa_: 2j4q A: [165891]
   automated match to d1xs1a_
   complexed with mg, ttp, tyd; mutant

Details for d2j4qa_

PDB Entry: 2j4q, 2.6 Å

PDB Description: crystal structure of a e138a escherichia coli dctp deaminase mutant enzyme in complex with dttp

PDB Compounds: (A:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2j4qa_:

Sequence; same for both SEQRES and ATOM records:

>d2j4qa_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrr

Timeline for d2j4qa_:

• d2j4qa_ first appeared in SCOPe 2.01
  
• d2j4qa_ appears in SCOPe 2.04
  
• d2j4qa_ appears in SCOPe 2.06
  
• d2j4qa_ appears in the current release, SCOPe 2.08