| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family) ![]() automatically mapped to Pfam PF00721 |
| Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins) |
| Protein Ribgrass mosaic virus [47201] (1 species) |
| Species Ribgrass mosaic virus [TaxId:51680] [47202] (1 PDB entry) |
| Domain d1rmva_: 1rmv A: [16589] protein/RNA complex |
PDB Entry: 1rmv (more details), 2.9 Å
SCOPe Domain Sequences for d1rmva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rmva_ a.24.5.1 (A:) Ribgrass mosaic virus {Ribgrass mosaic virus [TaxId: 51680]}
synitnsnqyqyfaavwaeptpmlnqcvsalsqsyqtqagrdtvrqqfanllstivapnq
rfpdtgfrvyvnsavikplyealmksfdtrnriieteeesrpsasevanatqrvddatva
irsqiqlllnelsnghgymnraefeailpwttapat
Timeline for d1rmva_: