SCOPe 2.08: Domain d1rmva_: 1rmv A:

Lineage for d1rmva_ (1rmv A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family)
   automatically mapped to Pfam PF00721

5. Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins)

6. Protein Ribgrass mosaic virus [47201] (1 species)

7. Species Ribgrass mosaic virus [TaxId:51680] [47202] (1 PDB entry)

8. Domain d1rmva_: 1rmv A: [16589]
   protein/RNA complex

Details for d1rmva_

PDB Entry: 1rmv, 2.9 Å

PDB Description: ribgrass mosaic virus, fiber diffraction

PDB Compounds: (A:) ribgrass mosaic virus coat protein

SCOPe Domain Sequences for d1rmva_:

Sequence; same for both SEQRES and ATOM records:

>d1rmva_ a.24.5.1 (A:) Ribgrass mosaic virus {Ribgrass mosaic virus [TaxId: 51680]}
synitnsnqyqyfaavwaeptpmlnqcvsalsqsyqtqagrdtvrqqfanllstivapnq
rfpdtgfrvyvnsavikplyealmksfdtrnriieteeesrpsasevanatqrvddatva
irsqiqlllnelsnghgymnraefeailpwttapat

Timeline for d1rmva_:

• d1rmva_ first appeared (with stable ids) in SCOP 1.55
  
• d1rmva_ appears in SCOPe 2.07