Lineage for d2j4lc_ (2j4l C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004957Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1004958Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1005082Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 1005083Protein automated matches [190728] (5 species)
    not a true protein
  7. 1005090Species Sulfolobus solfataricus [TaxId:2287] [187894] (1 PDB entry)
  8. 1005093Domain d2j4lc_: 2j4l C: [165881]
    automated match to d2bmua1
    complexed with mg, utp

Details for d2j4lc_

PDB Entry: 2j4l (more details), 2.8 Å

PDB Description: crystal structure of uridylate kinase from sulfolobus solfataricus in complex with utp to 2.8 angstrom resolution
PDB Compounds: (C:) uridylate kinase

SCOPe Domain Sequences for d2j4lc_:

Sequence, based on SEQRES records: (download)

>d2j4lc_ c.73.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv

Sequence, based on observed residues (ATOM records): (download)

>d2j4lc_ c.73.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mniilkisgkffdefrvgivtgggstarryiklareigigeayldllgiwasrlnaylvm
fslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqstaavaalvaeasssktlvvatn
vdgvyekdpvkliphlttqdlrkilegsqagtyelldplaikiverskirvivmnyrkln
riidilkgeevssiiepv

SCOPe Domain Coordinates for d2j4lc_:

Click to download the PDB-style file with coordinates for d2j4lc_.
(The format of our PDB-style files is described here.)

Timeline for d2j4lc_: