Lineage for d1cgme_ (1cgm E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699952Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family) (S)
    automatically mapped to Pfam PF00721
  5. 2699953Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins)
  6. 2699954Protein Cucumber green mottle mosaic virus [47199] (1 species)
  7. 2699955Species Cucumber green mottle mosaic virus, strain watermelon [TaxId:12235] [47200] (1 PDB entry)
  8. 2699956Domain d1cgme_: 1cgm E: [16588]

Details for d1cgme_

PDB Entry: 1cgm (more details), 3.4 Å

PDB Description: structure determination of cucumber green mottle mosaic virus by x-ray fiber diffraction. significance for the evolution of tobamoviruses
PDB Compounds: (E:) cucumber green mottle mosaic virus

SCOPe Domain Sequences for d1cgme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgme_ a.24.5.1 (E:) Cucumber green mottle mosaic virus {Cucumber green mottle mosaic virus, strain watermelon [TaxId: 12235]}
aynpitpskliafsasyvpvrtllnflvasqgtafqtqagrdsfreslsalpssvvdins
rfpdagfyaflngpvlrpifvsllsstdtrnrvievvdpsnpttaeslnavkrtddasta
araeidnliesiskgfdvydrasfeaafsvvwseattska

SCOPe Domain Coordinates for d1cgme_:

Click to download the PDB-style file with coordinates for d1cgme_.
(The format of our PDB-style files is described here.)

Timeline for d1cgme_: