![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family) ![]() automatically mapped to Pfam PF00721 |
![]() | Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins) |
![]() | Protein Cucumber green mottle mosaic virus [47199] (1 species) |
![]() | Species Cucumber green mottle mosaic virus, strain watermelon [TaxId:12235] [47200] (1 PDB entry) |
![]() | Domain d1cgme_: 1cgm E: [16588] |
PDB Entry: 1cgm (more details), 3.4 Å
SCOPe Domain Sequences for d1cgme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cgme_ a.24.5.1 (E:) Cucumber green mottle mosaic virus {Cucumber green mottle mosaic virus, strain watermelon [TaxId: 12235]} aynpitpskliafsasyvpvrtllnflvasqgtafqtqagrdsfreslsalpssvvdins rfpdagfyaflngpvlrpifvsllsstdtrnrvievvdpsnpttaeslnavkrtddasta araeidnliesiskgfdvydrasfeaafsvvwseattska
Timeline for d1cgme_: