Lineage for d1vtmp_ (1vtm P:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699952Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family) (S)
    automatically mapped to Pfam PF00721
  5. 2699953Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins)
  6. 2699960Protein Tobacco mosaic virus coat protein [47197] (1 species)
  7. 2699961Species Tobacco mosaic virus, vulgare strain [TaxId:12242] [47198] (8 PDB entries)
  8. 2699994Domain d1vtmp_: 1vtm P: [16587]
    protein/RNA complex

Details for d1vtmp_

PDB Entry: 1vtm (more details), 3.5 Å

PDB Description: structure of the u2 strain of tobacco mosaic virus refined at 3.5 angstroms resolution using x-ray fiber diffraction
PDB Compounds: (P:) coat protein

SCOPe Domain Sequences for d1vtmp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vtmp_ a.24.5.1 (P:) Tobacco mosaic virus coat protein {Tobacco mosaic virus, vulgare strain [TaxId: 12242]}
pytinspsqfvylssayadpvelinlctnalgnqfqtqqarttvqqqfadawkpspvmtv
rfpasdfyvyrynstldplitallnsfdtrnriievnnqpapntteivnatqrvddatva
irasinnlanelvrgtgmfnqagfetasglvwtttpat

SCOPe Domain Coordinates for d1vtmp_:

Click to download the PDB-style file with coordinates for d1vtmp_.
(The format of our PDB-style files is described here.)

Timeline for d1vtmp_: