SCOPe 2.08: Domain d1vtmp_: 1vtm P:

Lineage for d1vtmp_ (1vtm P:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family)
   automatically mapped to Pfam PF00721

5. Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins)

6. Protein Tobacco mosaic virus coat protein [47197] (1 species)

7. Species Tobacco mosaic virus, vulgare strain [TaxId:12242] [47198] (8 PDB entries)

8. Domain d1vtmp_: 1vtm P: [16587]
   protein/RNA complex

Details for d1vtmp_

PDB Entry: 1vtm, 3.5 Å

PDB Description: structure of the u2 strain of tobacco mosaic virus refined at 3.5 angstroms resolution using x-ray fiber diffraction

PDB Compounds: (P:) coat protein

SCOPe Domain Sequences for d1vtmp_:

Sequence; same for both SEQRES and ATOM records:

>d1vtmp_ a.24.5.1 (P:) Tobacco mosaic virus coat protein {Tobacco mosaic virus, vulgare strain [TaxId: 12242]}
pytinspsqfvylssayadpvelinlctnalgnqfqtqqarttvqqqfadawkpspvmtv
rfpasdfyvyrynstldplitallnsfdtrnriievnnqpapntteivnatqrvddatva
irasinnlanelvrgtgmfnqagfetasglvwtttpat

Timeline for d1vtmp_:

• d1vtmp_ first appeared (with stable ids) in SCOP 1.55
  
• d1vtmp_ appears in SCOPe 2.07