SCOPe 2.05: Domain d2j4ja_: 2j4j A:

Lineage for d2j4ja_ (2j4j A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [187893] (2 PDB entries)

8. Domain d2j4ja_: 2j4j A: [165867]
   automated match to d2bmua1
   complexed with 4tc, acp, co, mg, u5p

Details for d2j4ja_

PDB Entry: 2j4j, 2.1 Å

PDB Description: crystal structure of uridylate kinase from sulfolobus solfataricus in complex with ump and amppcp to 2.1 angstrom resolution

PDB Compounds: (A:) uridylate kinase

SCOPe Domain Sequences for d2j4ja_:

Sequence, based on SEQRES records:

>d2j4ja_ c.73.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv

Sequence, based on observed residues (ATOM records):

>d2j4ja_ c.73.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkileelldplaik
iverskirvivmnyrklnriidilkgeevssiiepv

Timeline for d2j4ja_:

• d2j4ja_ first appeared in SCOPe 2.01
  
• d2j4ja_ appears in SCOPe 2.04
  
• d2j4ja_ appears in SCOPe 2.06
  
• d2j4ja_ appears in the current release, SCOPe 2.08