Lineage for d2j4ha_ (2j4h A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083304Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2083305Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2083318Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. 2083319Species Escherichia coli [TaxId:562] [117336] (6 PDB entries)
    Uniprot P28248
  8. 2083350Domain d2j4ha_: 2j4h A: [165865]
    automated match to d1xs1a_
    complexed with mg, yyy; mutant

Details for d2j4ha_

PDB Entry: 2j4h (more details), 2.7 Å

PDB Description: crystal structure of a h121a escherichia coli dctp deaminase mutant enzyme
PDB Compounds: (A:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2j4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4ha_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
avtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrr

SCOPe Domain Coordinates for d2j4ha_:

Click to download the PDB-style file with coordinates for d2j4ha_.
(The format of our PDB-style files is described here.)

Timeline for d2j4ha_: