Lineage for d2j41d_ (2j41 D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990511Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 990512Protein automated matches [190123] (20 species)
    not a true protein
  7. 990619Species Staphylococcus aureus [TaxId:1280] [187532] (3 PDB entries)
  8. 990625Domain d2j41d_: 2j41 D: [165863]
    automated match to d1s96a_
    complexed with 5gp, k, so4

Details for d2j41d_

PDB Entry: 2j41 (more details), 1.9 Å

PDB Description: crystal structure of staphylococcus aureus guanylate monophosphate kinase
PDB Compounds: (D:) Guanylate kinase

SCOPe Domain Sequences for d2j41d_:

Sequence, based on SEQRES records: (download)

>d2j41d_ c.37.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
kgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdafe
alikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfifl
appslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelaknriqciv
eaehlkrerveakyrkmileak

Sequence, based on observed residues (ATOM records): (download)

>d2j41d_ c.37.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
kgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdafe
alikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfifl
appsearkevemmnlydyvvvndevelaknriqciveaehlkrerveakyrkmileak

SCOPe Domain Coordinates for d2j41d_:

Click to download the PDB-style file with coordinates for d2j41d_.
(The format of our PDB-style files is described here.)

Timeline for d2j41d_: