SCOPe 2.08: Domain d1a7ea_: 1a7e A:

Lineage for d1a7ea_ (1a7e A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.4: Hemerythrin-like [47188] (1 family)

5. Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
   Iron-binding proteins

6. Protein Myohemerythin [47193] (1 species)

7. Species Sipunculan worm (Themiste zostericola) [TaxId:6437] [47194] (3 PDB entries)

8. Domain d1a7ea_: 1a7e A: [16583]
   complexed with cl, ofo

Details for d1a7ea_

PDB Entry: 1a7e, 1.8 Å

PDB Description: hydroxomet myohemerythrin from themiste zostericola

PDB Compounds: (A:) myohemerythrin

SCOPe Domain Sequences for d1a7ea_:

Sequence; same for both SEQRES and ATOM records:

>d1a7ea_ a.24.4.1 (A:) Myohemerythin {Sipunculan worm (Themiste zostericola) [TaxId: 6437]}
gweipepyvwdesfrvfyeqldeehkkifkgifdcirdnsapnlatlvkvttnhftheea
mmdaakysevvphkkmhkdflekigglsapvdaknvdyckewnvnhikgtdfkykgkl

Timeline for d1a7ea_:

• d1a7ea_ first appeared (with stable ids) in SCOP 1.55, called d1a7e__
  
• d1a7ea_ appears in SCOPe 2.07