![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein automated matches [190435] (12 species) not a true protein |
![]() | Species Castor bean (Ricinus communis) [TaxId:3988] [187330] (3 PDB entries) |
![]() | Domain d2j2fe_: 2j2f E: [165820] automated match to d1oq4a_ complexed with fe; mutant |
PDB Entry: 2j2f (more details), 2.65 Å
SCOPe Domain Sequences for d2j2fe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j2fe_ a.25.1.2 (E:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} pfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgf deqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwt rawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqe radfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafa dmmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgl saegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
Timeline for d2j2fe_: