Lineage for d2j2fc_ (2j2f C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703609Species Castor bean (Ricinus communis) [TaxId:3988] [187330] (3 PDB entries)
  8. 2703612Domain d2j2fc_: 2j2f C: [165818]
    automated match to d1oq4a_
    complexed with fe; mutant

Details for d2j2fc_

PDB Entry: 2j2f (more details), 2.65 Å

PDB Description: the t199d mutant of stearoyl acyl carrier protein desaturase from ricinus communis (castor bean)
PDB Compounds: (C:) acyl-[acyl-carrier-protein] desaturase

SCOPe Domain Sequences for d2j2fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j2fc_ a.25.1.2 (C:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
adfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d2j2fc_:

Click to download the PDB-style file with coordinates for d2j2fc_.
(The format of our PDB-style files is described here.)

Timeline for d2j2fc_: