SCOPe 2.01: Domain d2j2fa_: 2j2f A:

Lineage for d2j2fa_ (2j2f A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (4 species)
   not a true protein

7. Species Castor bean (Ricinus communis) [TaxId:3988] [187330] (1 PDB entry)

8. Domain d2j2fa_: 2j2f A: [165816]
   automated match to d1oq4a_
   complexed with fe; mutant

Details for d2j2fa_

PDB Entry: 2j2f, 2.65 Å

PDB Description: the t199d mutant of stearoyl acyl carrier protein desaturase from ricinus communis (castor bean)

PDB Compounds: (A:) acyl-[acyl-carrier-protein] desaturase

SCOPe Domain Sequences for d2j2fa_:

Sequence; same for both SEQRES and ATOM records:

>d2j2fa_ a.25.1.2 (A:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
kpfmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdg
fdeqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiw
trawtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfq
eradfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlaf
admmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltg
lsaegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

Timeline for d2j2fa_:

• d2j2fa_ is new in SCOPe 2.01-stable
  
• d2j2fa_ appears in SCOPe 2.02
  
• d2j2fa_ appears in the current release, SCOPe 2.08