SCOPe 2.01: Domain d2j23b_: 2j23 B:

Lineage for d2j23b_ (2j23 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Malassezia sympodialis [TaxId:76777] [187890] (1 PDB entry)

8. Domain d2j23b_: 2j23 B: [165811]
   automated match to d1syra_

Details for d2j23b_

PDB Entry: 2j23, 1.41 Å

PDB Description: cross-reactivity and crystal structure of malassezia sympodialis thioredoxin (mala s 13), a member of a new pan-allergen family

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d2j23b_:

Sequence, based on SEQRES records:

>d2j23b_ c.47.1.0 (B:) automated matches {Malassezia sympodialis [TaxId: 76777]}
hhhhlvprgsvqvissydqfkqvtggdkvvvidfwatwcgpckmigpvfekisdtpagdk
vgfykvdvdeqsqiaqevgiramptfvffkngqkidtvvgadpsklqaaitqhsa

Sequence, based on observed residues (ATOM records):

>d2j23b_ c.47.1.0 (B:) automated matches {Malassezia sympodialis [TaxId: 76777]}
hhhhlvpvqvissydqfkqvtggdkvvvidfwatwcgpckmigpvfekisdtpagdkvgf
ykvdvdeqsqiaqevgiramptfvffkngqkidtvvgadpsklqaaitqhsa

Timeline for d2j23b_:

• d2j23b_ is new in SCOPe 2.01-stable
  
• d2j23b_ appears in SCOPe 2.02
  
• d2j23b_ appears in the current release, SCOPe 2.08, called d2j23b1