Lineage for d2mhra_ (2mhr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699908Superfamily a.24.4: Hemerythrin-like [47188] (1 family) (S)
  5. 2699909Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
    Iron-binding proteins
  6. 2699947Protein Myohemerythin [47193] (1 species)
  7. 2699948Species Sipunculan worm (Themiste zostericola) [TaxId:6437] [47194] (3 PDB entries)
  8. 2699949Domain d2mhra_: 2mhr A: [16581]
    complexed with azi, feo, so4

Details for d2mhra_

PDB Entry: 2mhr (more details), 1.3 Å

PDB Description: structure of myohemerythrin in the azidomet state at 1.7(slash)1.3 angstroms resolution
PDB Compounds: (A:) myohemerythrin

SCOPe Domain Sequences for d2mhra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhra_ a.24.4.1 (A:) Myohemerythin {Sipunculan worm (Themiste zostericola) [TaxId: 6437]}
gweipepyvwdesfrvfyeqldeehkkifkgifdcirdnsapnlatlvkvttnhftheea
mmdaakysevvphkkmhkdflekigglsapvdaknvdyckewlvnhikgtdfkykgkl

SCOPe Domain Coordinates for d2mhra_:

Click to download the PDB-style file with coordinates for d2mhra_.
(The format of our PDB-style files is described here.)

Timeline for d2mhra_: