SCOPe 2.08: Domain d2mhra_: 2mhr A:

Lineage for d2mhra_ (2mhr A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.4: Hemerythrin-like [47188] (1 family)

5. Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
   Iron-binding proteins

6. Protein Myohemerythin [47193] (1 species)

7. Species Sipunculan worm (Themiste zostericola) [TaxId:6437] [47194] (3 PDB entries)

8. Domain d2mhra_: 2mhr A: [16581]
   complexed with azi, feo, so4

Details for d2mhra_

PDB Entry: 2mhr, 1.3 Å

PDB Description: structure of myohemerythrin in the azidomet state at 1.7(slash)1.3 angstroms resolution

PDB Compounds: (A:) myohemerythrin

SCOPe Domain Sequences for d2mhra_:

Sequence; same for both SEQRES and ATOM records:

>d2mhra_ a.24.4.1 (A:) Myohemerythin {Sipunculan worm (Themiste zostericola) [TaxId: 6437]}
gweipepyvwdesfrvfyeqldeehkkifkgifdcirdnsapnlatlvkvttnhftheea
mmdaakysevvphkkmhkdflekigglsapvdaknvdyckewlvnhikgtdfkykgkl

Timeline for d2mhra_:

• d2mhra_ first appeared (with stable ids) in SCOP 1.55, called d2mhr__
  
• d2mhra_ appears in SCOPe 2.07