Lineage for d2j1yc_ (2j1y C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2377722Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2377884Protein automated matches [190198] (2 species)
    not a true protein
  7. 2377885Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2377916Domain d2j1yc_: 2j1y C: [165808]
    automated match to d1uola_
    complexed with ca, zn; mutant

Details for d2j1yc_

PDB Entry: 2j1y (more details), 1.69 Å

PDB Description: human p53 core domain mutant m133l-v203a-n239y-g245s-n268d
PDB Compounds: (C:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2j1yc_:

Sequence, based on SEQRES records: (download)

>d2j1yc_ b.2.5.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpyeppevgsdcttihynymcysscmgsmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenl

Sequence, based on observed residues (ATOM records): (download)

>d2j1yc_ b.2.5.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhersdglappqhlirvegnlraeylddrntfrhsvvv
pyeppevgsdcttihynymcysscmgsmnrrpiltiitledssgnllgrdsfevrvcacp
grdrrteeenl

SCOPe Domain Coordinates for d2j1yc_:

Click to download the PDB-style file with coordinates for d2j1yc_.
(The format of our PDB-style files is described here.)

Timeline for d2j1yc_: