SCOPe 2.07: Domain d1hrba_: 1hrb A:

Lineage for d1hrba_ (1hrb A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.4: Hemerythrin-like [47188] (1 family)

5. Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
   Iron-binding proteins

6. Protein Hemerythrin [47190] (2 species)

7. Species Phascolopsis gouldii [TaxId:6442] [47192] (3 PDB entries)

8. Domain d1hrba_: 1hrb A: [16580]
   complexed with fe

Details for d1hrba_

PDB Entry: 1hrb, 5.5 Å

PDB Description: atomic models for the polypeptide backbones of myohemerythrin and hemerythrin

PDB Compounds: (A:) hemerythrin b

SCOPe Domain Sequences for d1hrba_:

Sequence; same for both SEQRES and ATOM records:

>d1hrba_ a.24.4.1 (A:) Hemerythrin {Phascolopsis gouldii [TaxId: 6442]}
gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflnqev
lmeasqyqfydehkkehdgfinaldnwkgdvkwakawlvnhiktidfkykgki

Timeline for d1hrba_:

• d1hrba_ first appeared (with stable ids) in SCOP 1.55, called d1hrb__
  
• d1hrba_ appears in SCOPe 2.06
  
• d1hrba_ appears in the current release, SCOPe 2.08