Lineage for d1hrba_ (1hrb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311603Superfamily a.24.4: Hemerythrin-like [47188] (1 family) (S)
  5. 2311604Family a.24.4.1: Hemerythrin-like [47189] (2 protein domains)
    Iron-binding proteins
  6. 2311605Protein Hemerythrin [47190] (2 species)
  7. 2311606Species Phascolopsis gouldii [TaxId:6442] [47192] (3 PDB entries)
  8. 2311623Domain d1hrba_: 1hrb A: [16580]
    complexed with fe

Details for d1hrba_

PDB Entry: 1hrb (more details), 5.5 Å

PDB Description: atomic models for the polypeptide backbones of myohemerythrin and hemerythrin
PDB Compounds: (A:) hemerythrin b

SCOPe Domain Sequences for d1hrba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrba_ a.24.4.1 (A:) Hemerythrin {Phascolopsis gouldii [TaxId: 6442]}
gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflnqev
lmeasqyqfydehkkehdgfinaldnwkgdvkwakawlvnhiktidfkykgki

SCOPe Domain Coordinates for d1hrba_:

Click to download the PDB-style file with coordinates for d1hrba_.
(The format of our PDB-style files is described here.)

Timeline for d1hrba_: