SCOPe 2.06: Domain d2j0la_: 2j0l A:

Lineage for d2j0la_ (2j0l A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [187329] (14 PDB entries)

8. Domain d2j0la_: 2j0l A: [165790]
   automated match to d1mp8a_
   complexed with anp, mg, so4

Details for d2j0la_

PDB Entry: 2j0l, 2.3 Å

PDB Description: crystal structure of a the active conformation of the kinase domain of focal adhesion kinase with a phosphorylated activation loop.

PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2j0la_:

Sequence; same for both SEQRES and ATOM records:

>d2j0la_ d.144.1.7 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
strdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflq
ealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayql
stalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwma
pesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncppt
lyslmtkcwaydpsrrprftelkaqlstileeeklq

Timeline for d2j0la_:

• d2j0la_ first appeared in SCOPe 2.01
  
• d2j0la_ appears in SCOPe 2.05
  
• d2j0la_ appears in SCOPe 2.07
  
• d2j0la_ appears in the current release, SCOPe 2.08