SCOPe 2.08: Domain d2izxb_: 2izx B:

Lineage for d2izxb_ (2izx B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein automated matches [190321] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187886] (3 PDB entries)

8. Domain d2izxb_: 2izx B: [165776]
   automated match to d1l6ea_
   complexed with dtd

Details for d2izxb_

PDB Entry: 2izx, 1.3 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits

PDB Compounds: (B:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2izxb_:

Sequence; same for both SEQRES and ATOM records:

>d2izxb_ a.31.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqippgltellqgytvevlrqqppdlvefaveyftrlrear

Timeline for d2izxb_:

• d2izxb_ first appeared in SCOPe 2.01
  
• d2izxb_ appears in SCOPe 2.07