SCOPe 2.05: Domain d2izxa_: 2izx A:

Lineage for d2izxa_ (2izx A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein automated matches [190321] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187886] (2 PDB entries)

8. Domain d2izxa_: 2izx A: [165775]
   automated match to d1l6ea_
   complexed with dtd

Details for d2izxa_

PDB Entry: 2izx, 1.3 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits

PDB Compounds: (A:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2izxa_:

Sequence; same for both SEQRES and ATOM records:

>d2izxa_ a.31.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ippgltellqgytvevlrqqppdlvefaveyftrlrear

Timeline for d2izxa_:

• d2izxa_ first appeared in SCOPe 2.01
  
• d2izxa_ appears in SCOPe 2.04
  
• d2izxa_ appears in SCOPe 2.06
  
• d2izxa_ appears in the current release, SCOPe 2.08