Lineage for d2izxa_ (2izx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709186Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2709187Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2709188Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 2709206Protein automated matches [190321] (3 species)
    not a true protein
  7. 2709207Species Human (Homo sapiens) [TaxId:9606] [187886] (3 PDB entries)
  8. 2709208Domain d2izxa_: 2izx A: [165775]
    automated match to d1l6ea_
    complexed with dtd

Details for d2izxa_

PDB Entry: 2izx (more details), 1.3 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits
PDB Compounds: (A:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2izxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izxa_ a.31.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ippgltellqgytvevlrqqppdlvefaveyftrlrear

SCOPe Domain Coordinates for d2izxa_:

Click to download the PDB-style file with coordinates for d2izxa_.
(The format of our PDB-style files is described here.)

Timeline for d2izxa_: