Lineage for d2iyia_ (2iyi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953361Family d.58.10.2: BLUF domain [143364] (4 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. 2953382Protein automated matches [190725] (2 species)
    not a true protein
  7. 2953383Species Rhodobacter sphaeroides [TaxId:1063] [187884] (2 PDB entries)
  8. 2953386Domain d2iyia_: 2iyi A: [165773]
    automated match to d2buna1
    complexed with dtt, dtu, fmn

Details for d2iyia_

PDB Entry: 2iyi (more details), 2.95 Å

PDB Description: structure of a light-induced intermediate of the bluf domain of the rhodobacterial protein appa
PDB Compounds: (A:) appa, antirepressor of ppsr, sensor of blue light

SCOPe Domain Sequences for d2iyia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iyia_ d.58.10.2 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
sdlvscsyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaava
evmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslgla

SCOPe Domain Coordinates for d2iyia_:

Click to download the PDB-style file with coordinates for d2iyia_.
(The format of our PDB-style files is described here.)

Timeline for d2iyia_: