SCOPe 2.08: Domain d2iygb_: 2iyg B:

Lineage for d2iygb_ (2iyg B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families)

5. Family d.58.10.2: BLUF domain [143364] (4 proteins)
   Pfam PF04940; sensors of blue-light using FAD

6. Protein automated matches [190725] (2 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [187884] (2 PDB entries)

8. Domain d2iygb_: 2iyg B: [165772]
   automated match to d2buna1
   complexed with dtt, dtu, fmn

Details for d2iygb_

PDB Entry: 2iyg, 2.3 Å

PDB Description: dark state structure of the bluf domain of the rhodobacterial protein appa

PDB Compounds: (B:) appa, antirepressor of ppsr, sensor of blue light

SCOPe Domain Sequences for d2iygb_:

Sequence; same for both SEQRES and ATOM records:

>d2iygb_ d.58.10.2 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
sdlvscsyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaava
evmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslgla

Timeline for d2iygb_:

• d2iygb_ first appeared in SCOPe 2.01
  
• d2iygb_ appears in SCOPe 2.07