Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein automated matches [190401] (3 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [187273] (15 PDB entries) |
Domain d2iy6b_: 2iy6 B: [165766] automated match to d1uzba_ complexed with cl, flc, mpd, mrd, na |
PDB Entry: 2iy6 (more details), 1.8 Å
SCOPe Domain Sequences for d2iy6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy6b_ c.82.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 300852]} mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggkdaiivdet adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv gvqpfggfklsgtnaktgaldylrlflemkavaerf
Timeline for d2iy6b_: