Lineage for d2iy4t_ (2iy4 T:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702608Species Listeria monocytogenes [TaxId:1639] [187885] (1 PDB entry)
  8. 2702628Domain d2iy4t_: 2iy4 T: [165760]
    automated match to d1qgha_
    complexed with fe

Details for d2iy4t_

PDB Entry: 2iy4 (more details), 2.31 Å

PDB Description: x-ray structure of dps from listeria monocytogenes
PDB Compounds: (T:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2iy4t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy4t_ a.25.1.1 (T:) automated matches {Listeria monocytogenes [TaxId: 1639]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2iy4t_:

Click to download the PDB-style file with coordinates for d2iy4t_.
(The format of our PDB-style files is described here.)

Timeline for d2iy4t_: