| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Listeria monocytogenes [TaxId:1639] [187885] (1 PDB entry) |
| Domain d2iy4l_: 2iy4 L: [165752] automated match to d1qgha_ complexed with fe |
PDB Entry: 2iy4 (more details), 2.31 Å
SCOPe Domain Sequences for d2iy4l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy4l_ a.25.1.1 (L:) automated matches {Listeria monocytogenes [TaxId: 1639]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
vtndmliafkasidkhiwmfkaflgkaple
Timeline for d2iy4l_: