SCOPe 2.06: Domain d2ixib_: 2ixi B:

Lineage for d2ixib_ (2ixi B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Pseudomonas aeruginosa [TaxId:287] [101972] (5 PDB entries)

8. Domain d2ixib_: 2ixi B: [165738]
   automated match to d1rtva_
   complexed with srt, tyd

Details for d2ixib_

PDB Entry: 2ixi, 1.8 Å

PDB Description: rmlc p aeruginosa with dtdp-xylose

PDB Compounds: (B:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d2ixib_:

Sequence; same for both SEQRES and ATOM records:

>d2ixib_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]}
smsmkatrlaipdvilfeprvfgddrgfffesynqrafeeacghpvsfvqdnhsrsargv
lrglhyqirqaqgklvratlgevfdvavdlrrgsptfgqwvgerlsaenkrqmwipagfa
hgfvvlseyaeflykttdfwapehercivwndpelkidwplqdapllsekdrqgkafada
dcfp

Timeline for d2ixib_:

• d2ixib_ first appeared in SCOPe 2.01
  
• d2ixib_ appears in SCOPe 2.05
  
• d2ixib_ appears in SCOPe 2.07
  
• d2ixib_ appears in the current release, SCOPe 2.08