SCOPe 2.08: Domain d2ixfb_: 2ixf B:

Lineage for d2ixfb_ (2ixf B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein automated matches [190723] (8 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187882] (4 PDB entries)

8. Domain d2ixfb_: 2ixf B: [165733]
   automated match to d1jj7a_
   complexed with atp, gol, mg; mutant

Details for d2ixfb_

PDB Entry: 2ixf, 2 Å

PDB Description: crystal structure of the atpase domain of tap1 with atp (d645q, q678h mutant)

PDB Compounds: (B:) antigen peptide transporter 1

SCOPe Domain Sequences for d2ixfb_:

Sequence; same for both SEQRES and ATOM records:

>d2ixfb_ c.37.1.12 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
splsgslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstv
aallqnlyqptggkvlldgeplvqydhhylhtqvaavgqepllfgrsfreniaygltrtp
tmeeitavamesgahdfisgfpqgydtevgetgnqlsggqrqavalaralirkprllild
qatsaldagnqlrvqrllyespewasrtvllithqlslaerahhilflkegsvceqgthl
qlmerggcyrsmvea

Timeline for d2ixfb_:

• d2ixfb_ first appeared in SCOPe 2.01
  
• d2ixfb_ appears in SCOPe 2.07