SCOPe 2.08: Domain d2ixed_: 2ixe D:

Lineage for d2ixed_ (2ixe D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein automated matches [190723] (8 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187882] (4 PDB entries)

8. Domain d2ixed_: 2ixe D: [165731]
   automated match to d1jj7a_
   complexed with atp, mg, po4; mutant

Details for d2ixed_

PDB Entry: 2ixe, 2 Å

PDB Description: crystal structure of the atpase domain of tap1 with atp (d645n mutant)

PDB Compounds: (D:) antigen peptide transporter 1

SCOPe Domain Sequences for d2ixed_:

Sequence, based on SEQRES records:

>d2ixed_ c.37.1.12 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsgslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstvaa
llqnlyqptggkvlldgeplvqydhhylhtqvaavgqepllfgrsfreniaygltrtptm
eeitavamesgahdfisgfpqgydtevgetgnqlsggqrqavalaralirkprllildna
tsaldagnqlrvqrllyespewasrtvllitqqlslaerahhilflkegsvceqgthlql
merggcyrsmveala

Sequence, based on observed residues (ATOM records):

>d2ixed_ c.37.1.12 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsgslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstvaa
llqnlyqptggkvlldgeplvqydhhylhtqvaavgpllfgrsfreniaygltrtptmee
itavamesgahdfisgfpqgydtevqlsggqrqavalaralirkprllildnatsaldag
nqlrvqrllyespewasrtvllitqqlslaerahhilflkegsvceqgthlqlmerggcy
rsmveala

Timeline for d2ixed_:

• d2ixed_ first appeared in SCOPe 2.01
  
• d2ixed_ appears in SCOPe 2.07