Lineage for d2ixed_ (2ixe D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870403Protein automated matches [190723] (8 species)
    not a true protein
  7. 2870421Species Norway rat (Rattus norvegicus) [TaxId:10116] [187882] (4 PDB entries)
  8. 2870427Domain d2ixed_: 2ixe D: [165731]
    automated match to d1jj7a_
    complexed with atp, mg, po4; mutant

Details for d2ixed_

PDB Entry: 2ixe (more details), 2 Å

PDB Description: crystal structure of the atpase domain of tap1 with atp (d645n mutant)
PDB Compounds: (D:) antigen peptide transporter 1

SCOPe Domain Sequences for d2ixed_:

Sequence, based on SEQRES records: (download)

>d2ixed_ c.37.1.12 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsgslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstvaa
llqnlyqptggkvlldgeplvqydhhylhtqvaavgqepllfgrsfreniaygltrtptm
eeitavamesgahdfisgfpqgydtevgetgnqlsggqrqavalaralirkprllildna
tsaldagnqlrvqrllyespewasrtvllitqqlslaerahhilflkegsvceqgthlql
merggcyrsmveala

Sequence, based on observed residues (ATOM records): (download)

>d2ixed_ c.37.1.12 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsgslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstvaa
llqnlyqptggkvlldgeplvqydhhylhtqvaavgpllfgrsfreniaygltrtptmee
itavamesgahdfisgfpqgydtevqlsggqrqavalaralirkprllildnatsaldag
nqlrvqrllyespewasrtvllitqqlslaerahhilflkegsvceqgthlqlmerggcy
rsmveala

SCOPe Domain Coordinates for d2ixed_:

Click to download the PDB-style file with coordinates for d2ixed_.
(The format of our PDB-style files is described here.)

Timeline for d2ixed_: