SCOPe 2.01: Domain d2ixea_: 2ixe A:

Lineage for d2ixea_ (2ixe A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein automated matches [190723] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187882] (3 PDB entries)

8. Domain d2ixea_: 2ixe A: [165730]
   automated match to d1jj7a_
   complexed with atp, mg, po4; mutant

Details for d2ixea_

PDB Entry: 2ixe, 2 Å

PDB Description: crystal structure of the atpase domain of tap1 with atp (d645n mutant)

PDB Compounds: (A:) antigen peptide transporter 1

SCOPe Domain Sequences for d2ixea_:

Sequence; same for both SEQRES and ATOM records:

>d2ixea_ c.37.1.12 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstvaall
qnlyqptggkvlldgeplvqydhhylhtqvaavgqepllfgrsfreniaygltrtptmee
itavamesgahdfisgfpqgydtevgetgnqlsggqrqavalaralirkprllildnats
aldagnqlrvqrllyespewasrtvllitqqlslaerahhilflkegsvceqgthlqlme
rggcyrsmvea

Timeline for d2ixea_:

• d2ixea_ is new in SCOPe 2.01-stable
  
• d2ixea_ appears in SCOPe 2.02
  
• d2ixea_ appears in the current release, SCOPe 2.08