SCOPe 2.06: Domain d1hmdb_: 1hmd B:

Lineage for d1hmdb_ (1hmd B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.4: Hemerythrin-like [47188] (1 family)

5. Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
   Iron-binding proteins

6. Protein Hemerythrin [47190] (2 species)

7. Species Sipunculid worm (Themiste dyscritum) [TaxId:6436] [47191] (4 PDB entries)

8. Domain d1hmdb_: 1hmd B: [16573]
   complexed with ace, feo

Details for d1hmdb_

PDB Entry: 1hmd, 2 Å

PDB Description: the structure of deoxy and oxy hemerythrin at 2.0 angstroms resolution

PDB Compounds: (B:) hemerythrin

SCOPe Domain Sequences for d1hmdb_:

Sequence; same for both SEQRES and ATOM records:

>d1hmdb_ a.24.4.1 (B:) Hemerythrin {Sipunculid worm (Themiste dyscritum) [TaxId: 6436]}
gfpipdpycwdisfrtfytiiddehktlfngilllsqadnadhlnelrrctgkhflneqq
lmqssqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki

Timeline for d1hmdb_:

• d1hmdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hmdb_ appears in SCOPe 2.05
  
• d1hmdb_ appears in SCOPe 2.07
  
• d1hmdb_ appears in the current release, SCOPe 2.08