SCOPe 2.08: Domain d2ixdb_: 2ixd B:

Lineage for d2ixdb_ (2ixd B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.134: LmbE-like [102587] (1 superfamily)
   3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest; topological similarity to SAM-dependent methyltransferases

4. Superfamily c.134.1: LmbE-like [102588] (2 families)

5. Family c.134.1.0: automated matches [191370] (1 protein)
   not a true family

6. Protein automated matches [190448] (2 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [187356] (1 PDB entry)

8. Domain d2ixdb_: 2ixd B: [165729]
   automated match to d1uana_
   complexed with act, zn

Details for d2ixdb_

PDB Entry: 2ixd, 1.8 Å

PDB Description: crystal structure of the putative deacetylase bc1534 from bacillus cereus

PDB Compounds: (B:) lmbe-related protein

SCOPe Domain Sequences for d2ixdb_:

Sequence; same for both SEQRES and ATOM records:

>d2ixdb_ c.134.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
sglhilafgahaddveigmagtiakytkqgyevgicdlteadlssngtielrkeeakvaa
rimgvktrlnlampdrglymkeeyireivkvirtykpklvfapyyedrhpdhancaklve
eaifsagirkympelsphrvesfynymingfhkpnfcidiseylsikvealeayesqfst
gsdgvktpltegyvetviarekmfgkevgvlyaegfmskkpvllhadllgg

Timeline for d2ixdb_:

• d2ixdb_ first appeared in SCOPe 2.01
  
• d2ixdb_ appears in SCOPe 2.07