Lineage for d2ixda_ (2ixd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923289Fold c.134: LmbE-like [102587] (1 superfamily)
    3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest; topological similarity to SAM-dependent methyltransferases
  4. 2923290Superfamily c.134.1: LmbE-like [102588] (2 families) (S)
  5. 2923308Family c.134.1.0: automated matches [191370] (1 protein)
    not a true family
  6. 2923309Protein automated matches [190448] (2 species)
    not a true protein
  7. 2923310Species Bacillus cereus [TaxId:1396] [187356] (1 PDB entry)
  8. 2923311Domain d2ixda_: 2ixd A: [165728]
    automated match to d1uana_
    complexed with act, zn

Details for d2ixda_

PDB Entry: 2ixd (more details), 1.8 Å

PDB Description: crystal structure of the putative deacetylase bc1534 from bacillus cereus
PDB Compounds: (A:) lmbe-related protein

SCOPe Domain Sequences for d2ixda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixda_ c.134.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
sglhilafgahaddveigmagtiakytkqgyevgicdlteadlssngtielrkeeakvaa
rimgvktrlnlampdrglymkeeyireivkvirtykpklvfapyyedrhpdhancaklve
eaifsagirkympelsphrvesfynymingfhkpnfcidiseylsikvealeayesqfst
gsdgvktpltegyvetviarekmfgkevgvlyaegfmskkpvllhadllggck

SCOPe Domain Coordinates for d2ixda_:

Click to download the PDB-style file with coordinates for d2ixda_.
(The format of our PDB-style files is described here.)

Timeline for d2ixda_: