![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.134: LmbE-like [102587] (1 superfamily) 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest; topological similarity to SAM-dependent methyltransferases |
![]() | Superfamily c.134.1: LmbE-like [102588] (2 families) ![]() |
![]() | Family c.134.1.0: automated matches [191370] (1 protein) not a true family |
![]() | Protein automated matches [190448] (2 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:1396] [187356] (1 PDB entry) |
![]() | Domain d2ixda_: 2ixd A: [165728] automated match to d1uana_ complexed with act, zn |
PDB Entry: 2ixd (more details), 1.8 Å
SCOPe Domain Sequences for d2ixda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ixda_ c.134.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]} sglhilafgahaddveigmagtiakytkqgyevgicdlteadlssngtielrkeeakvaa rimgvktrlnlampdrglymkeeyireivkvirtykpklvfapyyedrhpdhancaklve eaifsagirkympelsphrvesfynymingfhkpnfcidiseylsikvealeayesqfst gsdgvktpltegyvetviarekmfgkevgvlyaegfmskkpvllhadllggck
Timeline for d2ixda_: