SCOPe 2.08: Domain d2iwtb_: 2iwt B:

Lineage for d2iwtb_ (2iwt B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
   automatically mapped to Pfam PF00197

6. Protein automated matches [190504] (3 species)
   not a true protein

7. Species Barley (Hordeum vulgare) [TaxId:4513] [187881] (1 PDB entry)

8. Domain d2iwtb_: 2iwt B: [165727]
   Other proteins in same PDB: d2iwta_
   automated match to d1avac_
   complexed with flc

Details for d2iwtb_

PDB Entry: 2iwt, 2.3 Å

PDB Description: thioredoxin h2 (hvtrxh2) in a mixed disulfide complex with the target protein basi

PDB Compounds: (B:) Alpha-amylase/subtilisin inhibitor

SCOPe Domain Sequences for d2iwtb_:

Sequence; same for both SEQRES and ATOM records:

>d2iwtb_ b.42.4.1 (B:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
aadpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfp
vritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsp
sgrenafriekysgaevheyklmssgdwcqdlgvfrdlkggawflgatepyhvvvfkkap
pa

Timeline for d2iwtb_:

• d2iwtb_ first appeared in SCOPe 2.01
  
• d2iwtb_ appears in SCOPe 2.07