Lineage for d2iwtb_ (2iwt B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792431Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
    automatically mapped to Pfam PF00197
  6. 2792468Protein automated matches [190504] (3 species)
    not a true protein
  7. 2792469Species Barley (Hordeum vulgare) [TaxId:4513] [187881] (1 PDB entry)
  8. 2792470Domain d2iwtb_: 2iwt B: [165727]
    Other proteins in same PDB: d2iwta_
    automated match to d1avac_
    complexed with flc

Details for d2iwtb_

PDB Entry: 2iwt (more details), 2.3 Å

PDB Description: thioredoxin h2 (hvtrxh2) in a mixed disulfide complex with the target protein basi
PDB Compounds: (B:) Alpha-amylase/subtilisin inhibitor

SCOPe Domain Sequences for d2iwtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwtb_ b.42.4.1 (B:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
aadpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfp
vritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsp
sgrenafriekysgaevheyklmssgdwcqdlgvfrdlkggawflgatepyhvvvfkkap
pa

SCOPe Domain Coordinates for d2iwtb_:

Click to download the PDB-style file with coordinates for d2iwtb_.
(The format of our PDB-style files is described here.)

Timeline for d2iwtb_: