Lineage for d2iwta_ (2iwt A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 993608Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 993609Protein automated matches [190056] (35 species)
    not a true protein
  7. 993644Species Barley (Hordeum vulgare) [TaxId:4513] [187880] (1 PDB entry)
  8. 993645Domain d2iwta_: 2iwt A: [165726]
    Other proteins in same PDB: d2iwtb_
    automated match to d1xfla_
    complexed with flc

Details for d2iwta_

PDB Entry: 2iwt (more details), 2.3 Å

PDB Description: thioredoxin h2 (hvtrxh2) in a mixed disulfide complex with the target protein basi
PDB Compounds: (A:) thioredoxin h isoform 2

SCOPe Domain Sequences for d2iwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwta_ c.47.1.0 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
evisvhsleqwtmqieeantakklvvidftaswcgpsrimapvfadlakkfpnavflkvd
vdelkpiaeqfsveamptflfmkegdvkdrvvgaikeeltakvglhaaa

SCOPe Domain Coordinates for d2iwta_:

Click to download the PDB-style file with coordinates for d2iwta_.
(The format of our PDB-style files is described here.)

Timeline for d2iwta_: