| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Barley (Hordeum vulgare) [TaxId:4513] [187880] (1 PDB entry) |
| Domain d2iwta_: 2iwt A: [165726] Other proteins in same PDB: d2iwtb_ automated match to d1xfla_ complexed with flc |
PDB Entry: 2iwt (more details), 2.3 Å
SCOPe Domain Sequences for d2iwta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwta_ c.47.1.0 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
evisvhsleqwtmqieeantakklvvidftaswcgpsrimapvfadlakkfpnavflkvd
vdelkpiaeqfsveamptflfmkegdvkdrvvgaikeeltakvglhaaa
Timeline for d2iwta_: