SCOPe 2.08: Domain d2iwta_: 2iwt A:

Lineage for d2iwta_ (2iwt A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Barley (Hordeum vulgare) [TaxId:4513] [187880] (1 PDB entry)

8. Domain d2iwta_: 2iwt A: [165726]
   Other proteins in same PDB: d2iwtb_
   automated match to d1xfla_
   complexed with flc

Details for d2iwta_

PDB Entry: 2iwt, 2.3 Å

PDB Description: thioredoxin h2 (hvtrxh2) in a mixed disulfide complex with the target protein basi

PDB Compounds: (A:) thioredoxin h isoform 2

SCOPe Domain Sequences for d2iwta_:

Sequence; same for both SEQRES and ATOM records:

>d2iwta_ c.47.1.0 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
evisvhsleqwtmqieeantakklvvidftaswcgpsrimapvfadlakkfpnavflkvd
vdelkpiaeqfsveamptflfmkegdvkdrvvgaikeeltakvglhaaa

Timeline for d2iwta_:

• d2iwta_ first appeared in SCOPe 2.01
  
• d2iwta_ appears in SCOPe 2.07