Lineage for d2iwna1 (2iwn A:373-463)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786490Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2786491Protein automated matches [190436] (9 species)
    not a true protein
  7. 2786505Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. 2786516Domain d2iwna1: 2iwn A:373-463 [165724]
    Other proteins in same PDB: d2iwna2, d2iwna3
    automated match to d1d5ga_

Details for d2iwna1

PDB Entry: 2iwn (more details), 1.35 Å

PDB Description: 3rd pdz domain of multiple pdz domain protein mpdz (casp target)
PDB Compounds: (A:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2iwna1:

Sequence, based on SEQRES records: (download)

>d2iwna1 b.36.1.0 (A:373-463) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setfdveltknvqglgitiagyigdkklepsgifvksitkssavehdgriqigdqiiavd
gtnlqgftnqqavevlrhtgqtvlltlmrrg

Sequence, based on observed residues (ATOM records): (download)

>d2iwna1 b.36.1.0 (A:373-463) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setfdveltknvqglgitiagyigdpsgifvksitkssavehdgriqigdqiiavdgtnl
qgftnqqavevlrhtgqtvlltlmrrg

SCOPe Domain Coordinates for d2iwna1:

Click to download the PDB-style file with coordinates for d2iwna1.
(The format of our PDB-style files is described here.)

Timeline for d2iwna1: