Lineage for d2iwna_ (2iwn A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2380194Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2380195Protein automated matches [190436] (8 species)
    not a true protein
  7. 2380209Species Human (Homo sapiens) [TaxId:9606] [187333] (99 PDB entries)
  8. 2380221Domain d2iwna_: 2iwn A: [165724]
    automated match to d1d5ga_

Details for d2iwna_

PDB Entry: 2iwn (more details), 1.35 Å

PDB Description: 3rd pdz domain of multiple pdz domain protein mpdz (casp target)
PDB Compounds: (A:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2iwna_:

Sequence, based on SEQRES records: (download)

>d2iwna_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smsetfdveltknvqglgitiagyigdkklepsgifvksitkssavehdgriqigdqiia
vdgtnlqgftnqqavevlrhtgqtvlltlmrrgetsv

Sequence, based on observed residues (ATOM records): (download)

>d2iwna_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smsetfdveltknvqglgitiagyigdpsgifvksitkssavehdgriqigdqiiavdgt
nlqgftnqqavevlrhtgqtvlltlmrrgetsv

SCOPe Domain Coordinates for d2iwna_:

Click to download the PDB-style file with coordinates for d2iwna_.
(The format of our PDB-style files is described here.)

Timeline for d2iwna_: