Lineage for d1hmda_ (1hmd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311603Superfamily a.24.4: Hemerythrin-like [47188] (1 family) (S)
  5. 2311604Family a.24.4.1: Hemerythrin-like [47189] (2 protein domains)
    Iron-binding proteins
  6. 2311605Protein Hemerythrin [47190] (2 species)
  7. 2311625Species Sipunculid worm (Themiste dyscritum) [TaxId:6436] [47191] (4 PDB entries)
  8. 2311634Domain d1hmda_: 1hmd A: [16572]
    complexed with ace, feo

Details for d1hmda_

PDB Entry: 1hmd (more details), 2 Å

PDB Description: the structure of deoxy and oxy hemerythrin at 2.0 angstroms resolution
PDB Compounds: (A:) hemerythrin

SCOPe Domain Sequences for d1hmda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmda_ a.24.4.1 (A:) Hemerythrin {Sipunculid worm (Themiste dyscritum) [TaxId: 6436]}
gfpipdpycwdisfrtfytiiddehktlfngilllsqadnadhlnelrrctgkhflneqq
lmqssqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki

SCOPe Domain Coordinates for d1hmda_:

Click to download the PDB-style file with coordinates for d1hmda_.
(The format of our PDB-style files is described here.)

Timeline for d1hmda_: