Lineage for d2iweg_ (2iwe G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380272Protein Azurin [49530] (6 species)
  7. 2380303Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
    Uniprot P00282
  8. 2380566Domain d2iweg_: 2iwe G: [165718]
    automated match to d1bexa_
    complexed with 2ih, zn; mutant

Details for d2iweg_

PDB Entry: 2iwe (more details), 2.83 Å

PDB Description: structure of a cavity mutant (h117g) of pseudomonas aeruginosa azurin
PDB Compounds: (G:) Azurin

SCOPe Domain Sequences for d2iweg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iweg_ b.6.1.1 (G:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpggsal
mkgtltlk

SCOPe Domain Coordinates for d2iweg_:

Click to download the PDB-style file with coordinates for d2iweg_.
(The format of our PDB-style files is described here.)

Timeline for d2iweg_: