![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Azurin [49530] (6 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries) Uniprot P00282 |
![]() | Domain d2iweg_: 2iwe G: [165718] automated match to d1bexa_ complexed with 2ih, zn; mutant |
PDB Entry: 2iwe (more details), 2.83 Å
SCOPe Domain Sequences for d2iweg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iweg_ b.6.1.1 (G:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpggsal mkgtltlk
Timeline for d2iweg_: