SCOPe 2.01: Domain d2iw4b_: 2iw4 B:

Lineage for d2iw4b_ (2iw4 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 6 strands, order 321456
   Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest

4. Superfamily c.107.1: DHH phosphoesterases [64182] (3 families)
   constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains

5. Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (2 proteins)

6. Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [69610] (5 PDB entries)
   Uniprot P37487

8. Domain d2iw4b_: 2iw4 B: [165715]
   automated match to d1k23c_
   complexed with 2pn, fe, gol, mg, mn, pg4, so4; mutant

Details for d2iw4b_

PDB Entry: 2iw4, 2.15 Å

PDB Description: crystal structure of basillus subtilis family ii inorganic pyrophosphatase mutant, h98q, in complex with pnp

PDB Compounds: (B:) Manganese-dependent inorganic pyrophosphatase

SCOPe Domain Sequences for d2iw4b_:

Sequence; same for both SEQRES and ATOM records:

>d2iw4b_ c.107.1.1 (B:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]}
mekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprl
vetaanevngvilvdhnerqqsikdieevqvlevidhqrianfetaeplyyraepvgcta
tilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeey
glnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleavisk
vvaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvv
pvltdamae

Timeline for d2iw4b_:

• d2iw4b_ is new in SCOPe 2.01-stable
  
• d2iw4b_ appears in SCOPe 2.02
  
• d2iw4b_ appears in the current release, SCOPe 2.08