Lineage for d2hmqd_ (2hmq D:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies) 
Superfamily a.24.4: Hemerythrin [47188] (1 family) 
Family a.24.4.1: Hemerythrin [47189] (2 proteins) 
Protein Hemerythrin [47190] (2 species) Species Sipunculid worm (Themiste dyscrita) [47191] (4 PDB entries) 
Domain d2hmqd_: 2hmq D: [16571]
Details for d2hmqd_
PDB Entry: 2hmq (more details), 1.66 Å
PDB Description: the structures of met and azidomet hemerythrin at 1.66 angstroms resolution
SCOP Domain Sequences for d2hmqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmqd_ a.24.4.1 (D:) Hemerythrin {Sipunculid worm (Themiste dyscrita)}
gfpipdpycwdisfrtfytivddehktlfngilllsqadnadhlnelrrctgkhflneqq
lmqasqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki
SCOP Domain Coordinates for d2hmqd_:
Click to download the PDB-style file with coordinates for d2hmqd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hmqd_:
- d2hmqd_ appears in SCOP 1.57
- d2hmqd_ appears in the current release, SCOPe 2.08
View in 3D
