SCOPe 2.05: Domain d2ivha_: 2ivh A:

Lineage for d2ivha_ (2ivh A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein automated matches [190311] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)

8. Domain d2ivha_: 2ivh A: [165708]
   automated match to d1m08a_
   protein/DNA complex; complexed with zn; mutant

Details for d2ivha_

PDB Entry: 2ivh, 2.8 Å

PDB Description: crystal structure of the nuclease domain of cole7 (h545q mutant) in complex with an 18-bp duplex dna

PDB Compounds: (A:) colcin-e7

SCOPe Domain Sequences for d2ivha_:

Sequence, based on SEQRES records:

>d2ivha_ d.4.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhqekpisqnggvydmdnisvvtpkr
hidihrgk

Sequence, based on observed residues (ATOM records):

>d2ivha_ d.4.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhqekpisvydmdnisvvtpkrhidi
hrgk

Timeline for d2ivha_:

• d2ivha_ first appeared in SCOPe 2.01
  
• d2ivha_ appears in SCOPe 2.04
  
• d2ivha_ appears in SCOPe 2.06
  
• d2ivha_ appears in the current release, SCOPe 2.08