Lineage for d2ivha_ (2ivh A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2155547Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2155548Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2155549Family d.4.1.1: HNH-motif [54061] (3 protein domains)
  6. 2155597Protein automated matches [190311] (2 species)
    not a true protein
  7. 2155601Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)
  8. 2155609Domain d2ivha_: 2ivh A: [165708]
    automated match to d1m08a_
    protein/DNA complex; complexed with zn; mutant

Details for d2ivha_

PDB Entry: 2ivh (more details), 2.8 Å

PDB Description: crystal structure of the nuclease domain of cole7 (h545q mutant) in complex with an 18-bp duplex dna
PDB Compounds: (A:) colcin-e7

SCOPe Domain Sequences for d2ivha_:

Sequence, based on SEQRES records: (download)

>d2ivha_ d.4.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhqekpisqnggvydmdnisvvtpkr
hidihrgk

Sequence, based on observed residues (ATOM records): (download)

>d2ivha_ d.4.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhqekpisvydmdnisvvtpkrhidi
hrgk

SCOPe Domain Coordinates for d2ivha_:

Click to download the PDB-style file with coordinates for d2ivha_.
(The format of our PDB-style files is described here.)

Timeline for d2ivha_: